CYP7B1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17872
Zusätzliche Namen:: CBAS3|CP7B|CYP7B1|SPG5A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAGEVSAATGRFSLERLGLPGLALAAALLLLALCLLVRRTRRPGEPPLIKGWLPYLGVVLNLRKDPLRFMKTLQKQHGDTFTVLLGGKYITFILDPFQYQ
Uniprot:: O75881
Synonyme:: 24-hydroxycholesterol 7-alpha-hydroxylase;25-hydroxycholesterol 7-alpha-hydroxylase;25/26-hydroxycholesterol 7-alpha-hydroxylase;3-hydroxysteroid 7-alpha hydroxylase;CBAS3;CP7B;cytochrome P450 7B1;cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1;oxysterol 7-alpha-hydroxylase;SPG5A
Weitere Details:: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. Mutations in this gene have been associated with hereditary spastic paraplegia (SPG5 or HSP), an autosomal recessive disorder.

Versandbedingungen:: Blue Ice