SMC2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17867
Zusätzliche Namen:: CAP-E|CAPE|SMC-2|SMC2|SMC2L1
Anwendung:: ELISA, WB
Molekulargewicht:: 135kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
Uniprot:: O95347
Synonyme:: CAP-E;CAPE;chromosome-associated protein E;SMC protein 2;SMC-2;SMC2 (structural maintenance of chromosomes 2, yeast)-like 1;SMC2L1;structural maintenance of chromosomes (SMC) family member, chromosome-associated protein E;structural maintenance of chromosomes protein 2;XCAP-E homolog
Weitere Details:: Predicted to enable ATP binding activity; chromatin binding activity; and single-stranded DNA binding activity. Involved in mitotic chromosome condensation. Located in condensed chromosome; cytoplasm; and nuclear lumen. Part of condensin complex.