USP12 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17862
Zusätzliche Namen:: UBH1|USP12|USP12L1
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGV
Uniprot:: O75317
Synonyme:: deubiquitinating enzyme 12;UBH1;ubiquitin carboxyl-terminal hydrolase 12;ubiquitin specific protease 12 like 1;ubiquitin thioesterase 12;ubiquitin thiolesterase 12;ubiquitin-hydrolyzing enzyme 1;ubiquitin-specific-processing protease 12;USP12L1
Weitere Details:: Enables cysteine-type endopeptidase activity and thiol-dependent deubiquitinase. Involved in protein deubiquitination. Predicted to be located in nucleoplasm. Predicted to be active in cytosol and nucleus.