A17857
eEF1A1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17857
- Zusätzliche Namen:
- CCS-3|CCS3|EE1A1|EEF-1|EEF1A|eEF1A-1|eEF1A1|EF-Tu|EF1A|EF1A1|EF1alpha1|GRAF-1EF|LENG7|PTI1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAA
- Uniprot:
- P68104
- Synonyme:
- CCS-3;CCS3;cervical cancer suppressor 3;CTCL tumor antigen;EE1A1;EEF-1;EEF1A;eEF1A-1;EF-1-alpha-1;EF-Tu;EF1A;EF1a-like protein;elongation factor 1 alpha subunit;elongation factor 1-alpha 1;elongation factor Tu;epididymis secretory sperm binding protein;eukaryotic elongation factor 1 A-1;eukaryotic translation elongation factor 1 alpha 1-like 14;glucocorticoid receptor AF-1 specific elongation factor;GRAF-1EF;LENG7;leukocyte receptor cluster (LRC) member 7;leukocyte receptor cluster member 7;prostate tumor-inducing protein 1;PTI1;translation elongation factor 1 alpha 1-like 14
- Weitere Details:
- This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes.
- Versandbedingungen:
- Blue Ice