CCDC137 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17856
Zusätzliche Namen:: CCDC137|RaRF
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QRSVSKDQPGRRSQMLRMLLSPGGVSQPLTASLARQRIVEEERERAVQAYRALKQRQQQLHGERPHLTSRKKPEPQ
Uniprot:: Q6PK04
Synonyme:: coiled-coil domain-containing protein 137;hepatocellular carcinoma related protein 2;RaRF;retinoic acid resistance factor
Weitere Details:: Enables RNA binding activity. Located in chromosome and fibrillar center.