A17853
VWC2L Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17853
- Zusätzliche Namen:
- A830006F12Rik|Brl|VWC2L
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRG
- Uniprot:
- Q505H4
- Synonyme:
- A830006F12Rik;B;Brl;bror;Brorin-like;von Willebrand factor C domain containing protein 2 like;von Willebrand factor C domain-containing protein 2-like
- Weitere Details:
- Acts upstream of or within negative regulation of BMP signaling pathway and positive regulation of neuron differentiation. Located in extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; central nervous system; hippocampus; hypothalamus; and thalamus. Orthologous to human VWC2L (von Willebrand factor C domain containing 2 like).
- Versandbedingungen:
- Blue Ice