A17849
NAP1L5 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17849
- Zusätzliche Namen:
- DRLM|NAP1L5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa/30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKI
- Uniprot:
- Q96NT1
- Synonyme:
- down-regulated in liver malignancy;DRLM;nucleosome assembly protein 1-like 5
- Weitere Details:
- This gene encodes a protein that shares sequence similarity to nucleosome assembly factors, but may be localized to the cytoplasm rather than the nucleus. Expression of this gene is downregulated in hepatocellular carcinomas. This gene is located within a differentially methylated region (DMR) and is imprinted and paternally expressed. There is a related pseudogene on chromosome 4.
- Versandbedingungen:
- Blue Ice



