CLVS2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17826
Zusätzliche Namen:: bA160A10.4|C6orf212|C6orf213|CLVS2|RLBP1L2
Anwendung:: ELISA, WB
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD
Uniprot:: Q5SYC1
Synonyme:: bA160A10.4;C6orf212;C6orf213;clathrin vesicle-associated Sec14 protein 2;clavesin-2;retinaldehyde binding protein 1-like 2;Retinaldehyde-binding protein 1-like 2;RLBP1L2
Weitere Details:: This gene encodes a protein that belongs to the SEC14/CRAL-TRIO family of proteins. A similar protein in rat is thought to function in the endosomal pathway between early endosomes and mature lysosomes.