ASB17 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17822
Zusätzliche Namen:: Asb-17|ASB17
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PSLQFLGQWGYHCYEPRIYRSLAKILRYVDLDGFDALLTDYIAFVEKSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCNLA
Uniprot:: Q8WXJ9
Synonyme:: ankyrin repeat and SOCS box protein 17;Asb-17
Weitere Details:: Predicted to be involved in intracellular signal transduction and protein ubiquitination. Predicted to be located in cytosol.