SFXN2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17817
Zusätzliche Namen:: SFXN2|SLC56A2
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IDAPRWDQRTFLGRVKHFLNITDPRTVFVSERELDWAKVMVEKSRMGVVPPGTQVEQLLYAKKLYDSAFHPDTGEKMNVIG
Uniprot:: Q96NB2
Synonyme:: sideroflexin-2;SLC56A2
Weitere Details:: Predicted to enable serine transmembrane transporter activity. Involved in mitochondrial transmembrane transport. Located in mitochondrion.