PGLYRP2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17814
Zusätzliche Namen:: HMFT0141|PGLYRP2|PGLYRPL|PGRP-L|PGRPL|tagL|tagL-alpha|tagl-beta|TAGL-like
Anwendung:: ELISA, WB
Molekulargewicht:: 62kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLL
Uniprot:: Q96PD5
Synonyme:: HMFT0141;N-acetylmuramoyl-L-alanine amidase;Peptidoglycan recognition protein 2;peptidoglycan recognition protein L;peptidoglycan recognition protein long;PGLYRPL;PGRP-L;PGRPL;tagL;tagL-alpha;tagl-beta;TAGL-like
Weitere Details:: This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. This protein hydrolyzes the link between N-acetylmuramoyl residues and L-amino acid residues in bacterial cell wall glycopeptides, and thus may play a scavenger role by digesting biologically active peptidoglycan into biologically inactive fragments.