PIGM Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A17811
Zusätzliche Namen:: GPI-MT-I|PIGM
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 49kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK
Uniprot:: Q9H3S5
Synonyme:: dol-P-Man dependent GPI mannosyltransferase;DPM:GlcN-(acyl-)PI mannosyltransferase;GPI mannosyltransferase 1;GPI mannosyltransferase I;GPI-MT-I;phosphatidylinositol-glycan biosynthesis class M protein;PIG-M mannosyltransferase
Weitere Details:: This gene encodes a transmembrane protein that is located in the endoplasmic reticulum and is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI)-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a mannosyltransferase, GPI-MT-I, that transfers the first mannose to GPI on the lumenal side of the endoplasmic reticulum.