MARVELD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17787
Zusätzliche Namen:: bA548K23.8|GB14|MARVD1|MARVELD1|MRVLDC1
Anwendung:: ELISA, WB
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA
Uniprot:: Q9BSK0
Synonyme:: bA548K23.8;GB14;MARVD1;MARVEL (membrane-associating) domain containing 1;MARVEL domain-containing protein 1;MRVLDC1;occludin;putative MARVEL domain-containing protein 1
Weitere Details:: Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in several cellular components, including cytoskeleton; nucleus; and plasma membrane. Predicted to be integral component of membrane.