[KO Validated] SLC25A22 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A17772
Zusätzliche Namen:: 22|DEE3|EIEE3|GC-1|GC1|NET44
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRSRGIAGLYK
Uniprot:: Q9H936
Synonyme:: DEE3;EIEE3;GC-1;GC1;glutamate/H(+) symporter 1;mitochondrial glutamate carrier 1;NET44;solute carrier family 25 (mitochondrial carrier: glutamate), member 22;Solute carrier family 25 member 22
Weitere Details:: This gene encodes a mitochondrial glutamate carrier. Mutations in this gene are associated with early infantile epileptic encephalopathy. Multiple alternatively spliced variants, encoding the same protein, have been identified.