A17770
VPS37B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17770
- Zusätzliche Namen:
- VPS37B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 31kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LLYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLP
- Uniprot:
- Q9H9H4
- Synonyme:
- ESCRT-I complex subunit VPS37B;hVps37B;vacuolar protein sorting 37 homolog B;vacuolar protein sorting 37B;vacuolar protein sorting-associated protein 37B;VPS37B, ESCRT-I subunit
- Weitere Details:
- Enables calcium-dependent protein binding activity. Involved in positive regulation of viral budding via host ESCRT complex. Located in endosome membrane; midbody; and plasma membrane. Part of ESCRT I complex.
- Versandbedingungen:
- Blue Ice