A17735
INPP5E Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17735
- Zusätzliche Namen:
- CORS1|CPD4|INPP5E|JBTS1|MORMS|pharbin|PPI5PIV
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LIREMRKGSIFKGFQEPDIHFLPSYKFDIGKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQ
- Uniprot:
- Q9NRR6
- Synonyme:
- 72 kDa inositol polyphosphate 5-phosphatase;CORS1;CPD4;JBTS1;MORMS;pharbin;Phosphatidylinositol 4,5-bisphosphate 5-phosphatase;phosphatidylinositol polyphosphate 5-phosphatase type IV;phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase;phosphatidylinositol-4,5-bisphosphate 5-phosphatase;PPI5PIV
- Weitere Details:
- The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1,4,5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation. Studies of the mouse counterpart suggest that this protein may hydrolyze phosphatidylinositol 3,4,5-trisphosphate and phosphatidylinositol 3,5-bisphosphate on the cytoplasmic Golgi membrane and thereby regulate Golgi-vesicular trafficking. Mutations in this gene cause Joubert syndrome; a clinically and genetically heterogenous group of disorders characterized by midbrain-hindbrain malformation and various associated ciliopathies that include retinal dystrophy, nephronophthisis, liver fibrosis and polydactyly. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice