TRNT1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A17699
Zusätzliche Namen:: CCA1|CGI-47|MtCCA|RPEM|SIFD|TRNT1
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKNVDGFSPKPVTLLASLFKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT
Uniprot:: Q96Q11
Synonyme:: ATP(CTP):tRNA nucleotidyltransferase;CCA tRNA nucleotidyltransferase 1, mitochondrial;CCA-adding enzyme;CCA1;CGI-47;mitochondrial CCA-adding tRNA-nucleotidyltransferase;Mitochondrial tRNA nucleotidyl transferase, CCA-adding;mt CCA-adding enzyme;mt tRNA adenylyltransferase;mt tRNA CCA-diphosphorylase;mt tRNA CCA-pyrophosphorylase;MtCCA;RPEM;SIFD;tRNA CCA nucleotidyl transferase 1;tRNA nucleotidyl transferase, CCA-adding, 1;tRNA-nucleotidyltransferase 1, mitochondrial
Weitere Details:: The protein encoded by this gene is a CCA-adding enzyme which belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. This essential enzyme functions by catalyzing the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules. Mutations in this gene result in sideroblastic anemia with B-cell immunodeficiency, periodic fevers, and developmental delay. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice