ALG5 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A17693
Zusätzliche Namen:: ALG5|bA421P11.2|PKD7
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQM
Uniprot:: Q9Y673
Synonyme:: Alg5, S. cerevisiae, homolog of;asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase);asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase);asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog;asparagine-linked glycosylation protein 5 homolog;bA421P11.2;dolichyl phosphate glucosyltransferase;dolichyl-phosphate beta-glucosyltransferase;dolP-glucosyltransferase
Weitere Details:: This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice