RNF115 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17687
Zusätzliche Namen:: BCA2|RABRING7|RNF115|ZFP364|ZNF364
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA
Uniprot:: Q9Y4L5
Synonyme:: BCA2;E3 ubiquitin-protein ligase RNF115;rabring 7;RING finger protein 115;RING-type E3 ubiquitin transferase RNF115;zinc finger protein 364;ZNF364
Weitere Details:: Enables ubiquitin-protein transferase activity. Involved in negative regulation of epidermal growth factor receptor signaling pathway; protein autoubiquitination; and ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway. Predicted to be located in cytosol.