A17683
HEYL Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17683
- Zusätzliche Namen:
- bHLHb33|HESR3|HEY3|HEYL|HRT3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHA
- Uniprot:
- Q9NQ87
- Synonyme:
- bHLHb33;class B basic helix-loop-helix protein 33;hairy-related transcription factor 3;hairy/enhancer-of-split related with YRPW motif 3;hairy/enhancer-of-split related with YRPW motif-like protein;HESR3;HEY-like protein;HEY3;hHeyL;hHRT3;HRT-3;HRT3
- Weitere Details:
- This gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcription factors. The sequence of the encoded protein contains a conserved bHLH and orange domain, but its YRPW motif has diverged from other HESR family members. It is thought to be an effector of Notch signaling and a regulator of cell fate decisions. Alternatively spliced transcript variants have been found, but their biological validity has not been determined.
- Versandbedingungen:
- Blue Ice