A17657
RTF1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17657
- Zusätzliche Namen:
- GTL7|KIAA0252|RTF1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVY
- Uniprot:
- Q92541
- Synonyme:
- GTL7;KIAA0252;ortholog of mouse gene trap locus 7;RNA polymerase-associated protein RTF1 homolog;Rtf1, Paf1/RNA polymerase II complex component, homolog
- Weitere Details:
- This locus may represent a gene involved in regulation of transcription elongation and chromatin remodeling, based on studies of similar proteins in other organisms. The encoded protein may bind single-stranded DNA.
- Versandbedingungen:
- Blue Ice