A17627
FGFR1OP Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17627
- Zusätzliche Namen:
- FGFR1OP|FOP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKD
- Uniprot:
- O95684
- Synonyme:
- centrosomal protein 43;FGFR1 oncogene partner;FGFR1OP;fibroblast growth factor receptor 1 oncogene partner;FOP
- Weitere Details:
- This gene encodes a largely hydrophilic centrosomal protein that is required for anchoring microtubules to subcellular structures. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. Alterations in this gene may also be associated with Crohn's disease, Graves' disease, and vitiligo. Alternatively spliced transcript variants that encode different proteins have been identified.
- Versandbedingungen:
- Blue Ice

