NMUR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17610
Zusätzliche Namen:: (FM-3)|FM-3|FM3|GPC-R|GPR66|NMU1R|NMUR1
Anwendung:: ELISA, WB
Molekulargewicht:: 53kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS
Uniprot:: Q9HB89
Synonyme:: (FM-3);FM-3;FM3;G-protein coupled receptor 66;G-protein coupled receptor FM-3;GPC-R;GPR66;neuromedin-U receptor 1;NMU-R1;NMU1R
Weitere Details:: Enables neuromedin U binding activity and neuromedin U receptor activity. Involved in several processes, including activation of phospholipase C activity; chloride transport; and second-messenger-mediated signaling. Is integral component of membrane.