A17608
SF3B4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17608
- Zusätzliche Namen:
- AFD1|Hsh49|SAP49|SF3B4|SF3b49
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 44kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP
- Uniprot:
- Q15427
- Synonyme:
- AFD1;Hsh49;pre-mRNA-splicing factor SF3b 49 kDa subunit;SAP 49;SAP49;SF3b49;SF3b50;spliceosomal protein;spliceosome-associated protein (U2 snRNP);spliceosome-associated protein 49;splicing factor 3B subunit 4;splicing factor 3b, subunit 4, 49kD;splicing factor 3b, subunit 4, 49kDa
- Weitere Details:
- This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.
- Versandbedingungen:
- Blue Ice