A1760
CD1D Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1760
- Zusätzliche Namen:
- CD1A|CD1D|R3|R3G1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 38kDa/50kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSG
- Uniprot:
- P15813
- Synonyme:
- antigen-presenting glycoprotein CD1d;CD1A;CD1D antigen, d polypeptide;differentiation antigen CD1-alpha-3;HMC class I antigen-like glycoprotein CD1D;R3;R3G1;T-cell surface glycoprotein CD1d;thymocyte antigen CD1D
- Weitere Details:
- This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



