RNF144A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17597
Zusätzliche Namen:: hUIP4|RNF144|RNF144A|UBCE7IP4|UIP4
Anwendung:: ELISA, WB
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD
Uniprot:: P50876
Synonyme:: E3 ubiquitin-protein ligase RNF144A;hUIP4;probable E3 ubiquitin-protein ligase RNF144A;ring finger protein 144;RING finger protein 144A;RNF144;UBCE7IP4;UbcM4-interacting protein 4;ubiquitin conjugating enzyme 7 interacting protein 4;Ubiquitin-conjugating enzyme 7-interacting protein 4;UIP4
Weitere Details:: This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development.