COG1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17594
Zusätzliche Namen:: CDG2G|COG1|LDLB
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 109kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DSRIEKVTDHLEALIDPFDLDVFTPHLNSNLHRLVQRTSVLFGLVTGTENQLAPRSSTFNSQEPHNILPLASSQIRFGLLPLSMTSTRKAKSTRNIETKAQ
Uniprot:: Q8WTW3
Synonyme:: CDG2G;COG complex subunit 1;Component of oligomeric Golgi complex 1;conserved oligomeric Golgi complex protein 1;conserved oligomeric Golgi complex subunit 1;LDLB;low density lipoprotein receptor defect B complementing
Weitere Details:: The protein encoded by this gene is one of eight proteins (Cog1-8) which form a Golgi-localized complex (COG) required for normal Golgi morphology and function. It is thought that this protein is required for steps in the normal medial and trans Golgi-associated processing of glycoconjugates and plays a role in the organization of the Golgi-localized complex.