SYNJ1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17581
Zusätzliche Namen:: DEE53|EIEE53|INPP5G|PARK20|SYNJ1
Anwendung:: ELISA, WB
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWN
Uniprot:: O43426
Synonyme:: DEE53;EIEE53;inositol 5'-phosphatase (synaptojanin 1);inositol polyphosphate-5-phosphatase G;INPP5G;PARK20;phosphoinositide 5-phosphatase;synaptic inositol 1,4,5-trisphosphate 5-phosphatase 1;synaptojanin-1;synaptojanin-1, polyphosphoinositide phosphatase
Weitere Details:: This gene encodes a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking. Multiple transcript variants encoding different isoforms have been found for this gene.