A17563
VPS18 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A17563
- Zusätzliche Namen:
- PEP3|VPS18
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV
- Uniprot:
- Q9P253
- Synonyme:
- hVPS18;PEP3;vacuolar protein sorting 18 homolog;vacuolar protein sorting protein 18;vacuolar protein sorting-associated protein 18 homolog;VPS18, CORVET/HOPS core subunit
- Weitere Details:
- Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.
- Versandbedingungen:
- Blue Ice

