ZIC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17547
Zusätzliche Namen:: BAIDCS|CRS6|ZIC|ZIC1|ZNF201
Anwendung:: ELISA, WB
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LFAASAGGFGGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPRSEHYAAPQLHGYGPMNVNMAAHHGA
Uniprot:: Q15915
Synonyme:: BAIDCS;CRS6;ZIC;Zic family member 1 (odd-paired homolog, Drosophila);zinc finger protein 201;Zinc finger protein of the cerebellum 1;zinc finger protein ZIC 1;ZNF201
Weitere Details:: This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.