TNFAIP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17543
Zusätzliche Namen:: B12|B61|BTBD34|EDP1|hBACURD2|TNFAIP1
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKL
Uniprot:: Q13829
Synonyme:: B12;B61;BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2;BTB/POZ domain-containing protein TNFAIP1;BTBD34;EDP1;hBACURD2;Protein B12;tumor necrosis factor, alpha induced protein 1;tumor necrosis factor, alpha-induced protein 1 (endothelial);Tumor necrosis factor, alpha-induced protein 1, endothelial
Weitere Details:: This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner.