A17524
MAP4K2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17524
- Zusätzliche Namen:
- BL44|GCK|MAP4K2|RAB8IP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- WAHDLPGLFEQRRLQQQVPLSIPTNRLTQRIIPRRFALSTKIPDTKGCLQCRVVRNPYTGATFLLAALPTSLLLLQWYEPLQKFLLLKNFSSPLPSPAGMLEPLVLDGKELPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEGIPGSAQQVIQVDRDTILVSFERCVRIVNMQGEPTATLAPELTFDFPIETVVCLQDSVLAFWSHGMQGRSLDTNEVTQEITDETRIFRVLGAHRDIILESIPTDNPEAHSNLYILTGHQSTY
- Uniprot:
- Q12851
- Synonyme:
- B lymphocyte serine/threonine protein kinase;B lymphocyte serine/threonine-protein kinase;BL44;GCK;Germinal center kinase;germinal centre kinase (GC kinase);MAPK/ERK kinase kinase kinase 2;MEK kinase kinase 2;MEKKK 2;mitogen-activated protein kinase kinase kinase kinase 2;Rab8 interacting protein;Rab8-interacting protein;RAB8IP
- Weitere Details:
- The protein encoded by this gene is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice