TRPM1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17509
Zusätzliche Namen:: CSNB1C|LTRPC1|MLSN1|TRPM1
Anwendung:: ELISA, WB
Molekulargewicht:: 182kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPD
Uniprot:: Q7Z4N2
Synonyme:: CSNB1C;long transient receptor potential channel 1;LTRPC1;melastatin-1;MLSN1;transient receptor potential cation channel subfamily M member 1;transient receptor potential melastatin family
Weitere Details:: This gene encodes a member of the transient receptor potential melastatin subfamily of transient receptor potential ion channels. The encoded protein is a calcium permeable cation channel that is expressed in melanocytes and may play a role in melanin synthesis. Specific mutations in this gene are the cause autosomal recessive complete congenital stationary night blindness-1C. The expression of this protein is inversely correlated with melanoma aggressiveness and as such it is used as a prognostic marker for melanoma metastasis. Alternate splicing results in multiple transcript variants.