A17506
LAD1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17506
- Zusätzliche Namen:
- LAD1|LadA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 54kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TTDDEAPRLSQNGDRQASASERLPSVEEAEVPKPLPPASKDEDEDIQSILRTRQERRQRRQVVEAAQAPIQERLEAEEGRNSLSPVQATQKPLVSKKELEIPPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKT
- Uniprot:
- O00515
- Synonyme:
- lad-1;LadA;ladinin-1;linear IgA bullous dermatosis antigen;Linear IgA disease antigen;linear IgA disease antigen homolog
- Weitere Details:
- The protein encoded by this gene may be an anchoring filament that is a component of basement membranes. It may contribute to the stability of the association of the epithelial layers with the underlying mesenchyme.
- Versandbedingungen:
- Blue Ice