ITGA3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17502
Zusätzliche Namen:: CD49C|FRP-2|GAP-B3|GAPB3|ILNEB|ITGA3|JEB7|MSK18|VCA-2|VL3A|VLA3a
Anwendung:: ELISA, WB
Molekulargewicht:: 125kDa/130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIEDMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFI
Uniprot:: P26006
Synonyme:: alpha 3 subunit of VLA-3 receptor;antigen CD49C;antigen identified by monoclonal antibody J143;CD49 antigen-like family member C;CD49C;FRP-2;galactoprotein B3;GAP-B3;GAPB3;ILNEB;integrin alpha 3;integrin alpha-3;integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor);MSK18;testicular tissue protein Li 96;testicular tissue protein Li 98;VCA-2;very late activation protein 3 receptor, alpha-3 subunit;VL3A;VLA-3 subunit alpha;VLA3a
Weitere Details:: The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.

Versandbedingungen:: Blue Ice