GK2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17488
Zusätzliche Namen:: GK2|GKP2|GKTA
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 56kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS
Uniprot:: Q14410
Synonyme:: ATP:glycerol 3-phosphotransferase 2;GKP2;GKTA;glycerokinase 2;glycerol kinase 2;glycerol kinase pseudogene 2;glycerol kinase testis specific 2;Glycerol kinase, testis specific 2;testis tissue sperm-binding protein Li 77m
Weitere Details:: Predicted to enable glycerol kinase activity. Predicted to be involved in several processes, including glycerol metabolic process; glycerol-3-phosphate biosynthetic process; and triglyceride metabolic process. Located in extracellular exosome.