FCGR1B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17483
Zusätzliche Namen:: CD34|CD64b|FCG1|FcgammaRIa|FCGR1|FCGR1B|FcRI|IGFR1|IGFRB
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVL
Uniprot:: Q92637
Synonyme:: CD34;CD64b;Fc fragment of IgG, high affinity Ib, receptor (CD64);Fc gamma receptor Ib;Fc-gamma receptor I B2;Fc-gamma RI;Fc-gamma RIA;fc-gamma RIB;FCG1;FcgammaRIa;FCGR1;FcRI;fcRIB;hFcgammaRIB;High affinity immunoglobulin gamma Fc receptor I;high affinity immunoglobulin gamma Fc receptor IB;IGFR1;IGFRB;IgG Fc receptor I;igG Fc receptor IB
Weitere Details:: Three distinct, but closely related classes of receptors that bind the Fc portion of IgG have been identified (Fcgamma RI, II and III). The FcgammaRI family consists of three closely related genes termed A, B, and C. This gene likely encodes a non-functional protein that is not detectable at the cell surface and binds ligand with low affinity.