Septin 1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17471
Zusätzliche Namen:: DIFF6|LARP|PNUTL3|SEP1|SEPT1|Septin 1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPM
Uniprot:: Q8WYJ6
Synonyme:: DIFF6;differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase);LARP;peanut-like protein 3;PNUTL3;SEP1;SEPT1;septin-1;serologically defined breast cancer antigen NY-BR-24
Weitere Details:: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined.