COL9A2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17461
Zusätzliche Namen:: COL9A2|DJ39G22.4|EDM2|MED|STL5
Anwendung:: ELISA, WB
Molekulargewicht:: 65kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RGEKGDPGEVGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGLPGPVGLPGFCEPAACLGASAYASARLTEPGSIKGP
Uniprot:: Q14055
Synonyme:: alpha 2 type IX collagen;collagen alpha-2(IX) chain;collagen IX, alpha-2 polypeptide;collagen, type IX, alpha 2;DJ39G22.4;EDM2;MED;STL5
Weitere Details:: This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. This chain is unusual in that, unlike the other two type IX alpha chains, it contains a covalently attached glycosaminoglycan side chain. Mutations in this gene are associated with multiple epiphyseal dysplasia.