A1744
PTH1R Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1744
- Zusätzliche Namen:
- EKNS|PFE|PTH1R|PTHR|PTHR1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 66kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
- Uniprot:
- Q03431
- Synonyme:
- EKNS;Parathyroid hormone 1 receptor;parathyroid hormone receptor 1;parathyroid hormone/parathyroid hormone-related peptide receptor;parathyroid hormone/parathyroid hormone-related protein receptor;PFE;PTH/PTHr receptor;PTH/PTHrP type I receptor;PTH1 receptor;PTHR;PTHR1;seven transmembrane helix receptor
- Weitere Details:
- The protein encoded by this gene is a member of the G-protein coupled receptor family 2. This protein is a receptor for parathyroid hormone (PTH) and for parathyroid hormone-like hormone (PTHLH). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in this receptor are known to be the cause of Jansen's metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), as well as enchodromatosis. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice



