CHRNA5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1741
Zusätzliche Namen:: CHRNA5|LNCR2
Anwendung:: ELISA, WB
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
Uniprot:: P30532
Synonyme:: acetylcholine receptor, nicotinic, alpha 5 (neuronal);Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5;cholinergic receptor, nicotinic alpha 5;cholinergic receptor, nicotinic, alpha 5 (neuronal);LNCR2;neuronal acetylcholine receptor subunit alpha-5;neuronal nicotinic acetylcholine receptor, alpha5 subunit
Weitere Details:: The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).