A17408
JNK3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17408
- Zusätzliche Namen:
- JNK3|JNK3A|p493F12|p54bSAPK|PRKM10|SAPK1b
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMN
- Uniprot:
- P53779
- Synonyme:
- c-Jun N-terminal kinase 3;JNK3;JNK3 alpha protein kinase;JNK3A;MAP kinase 10;MAP kinase p49 3F12;mitogen-activated protein kinase 10;p493F12;p54bSAPK;PRKM10;SAPK1b;stress activated protein kinase beta;stress-activated protein kinase 1b;stress-activated protein kinase JNK3
- Weitere Details:
- The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system, and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
- Versandbedingungen:
- Blue Ice