A17389
ITCH Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17389
- Zusätzliche Namen:
- ADMFD|AIF4|AIP4|ITCH|NAPP1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETT
- Uniprot:
- Q96J02
- Synonyme:
- ADMFD;AIF4;AIP4;atrophin-1 interacting protein 4;Atrophin-1-interacting protein 4;E3 ubiquitin-protein ligase Itchy homolog;HECT-type E3 ubiquitin transferase Itchy homolog;itchy E3 ubiquitin protein ligase homolog;NAPP1;NFE2-associated polypeptide 1
- Weitere Details:
- This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice