A17378
ATRX Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17378
- Zusätzliche Namen:
- ATRX|JMS|MRX52|RAD54|RAD54L|XH2|XNP|ZNF-HX
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 310kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- EEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFT
- Uniprot:
- P46100
- Synonyme:
- alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae);ATP-dependent helicase ATRX;JMS;MRX52;RAD54;RAD54L;transcriptional regulator ATRX;X-linked helicase II;X-linked nuclear protein;XH2;XNP;ZNF-HX
- Weitere Details:
- The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Mutations in this gene are associated with X-linked syndromes exhibiting cognitive disabilities as well as alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
- Versandbedingungen:
- Blue Ice



