RUNX1T1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1737
Zusätzliche Namen:: AML1-MTG8|AML1T1|CBFA2T1|CDR|ETO|MTG8|RUNX1T1|ZMYND2
Anwendung:: ELISA, WB
Molekulargewicht:: 68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLK
Uniprot:: Q06455
Synonyme:: acute myelogenous leukemia 1 translocation 1, cyclin-D related;AML1-MTG8;AML1T1;CBFA2T1;CDR;core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D-related;Cyclin-D-related protein;eight twenty one protein;ETO;MTG8;myeloid translocation gene on 8q22;protein CBFA2T1;Protein ETO;Protein MTG8;runt related transcription factor 1; translocated to, 1 (cyclin D related);RUNX1 translocation partner 1;zinc finger MYND domain-containing protein 2;ZMYND2
Weitere Details:: This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice