DOCK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17359
Zusätzliche Namen:: ced5|DOCK1|DOCK180
Anwendung:: ELISA, WB
Molekulargewicht:: 215kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: QTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ
Uniprot:: B2RUU3
Synonyme:: 180 kDa protein downstream of CRK;ced5;dedicator of cytokinesis protein 1;DOCK180;DOwnstream of CrK
Weitere Details:: This gene encodes a member of the dedicator of cytokinesis protein family. Dedicator of cytokinesis proteins act as guanine nucleotide exchange factors for small Rho family G proteins. The encoded protein regulates the small GTPase Rac, thereby influencing several biological processes, including phagocytosis and cell migration. Overexpression of this gene has also been associated with certain cancers. Alternative splicing results in multiple transcript variants.