A17338
CLEC2B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17338
- Zusätzliche Namen:
- AICL|CLEC2B|CLECSF2|HP10085|IFNRG1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- IGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS
- Uniprot:
- Q92478
- Synonyme:
- activation-induced C-type lectin;AICL;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 2 (activation-induced);C-type lectin domain family 2 member B;C-type lectin superfamily member 2;CLECSF2;HP10085;IFN-alpha-2b-inducing-related protein 1;IFN-alpha2b-inducing related protein 1;IFNRG1
- Weitere Details:
- This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell activation antigen. An alternative splice variant has been described but its full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
- Versandbedingungen:
- Blue Ice