A17245
GORAB Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17245
- Zusätzliche Namen:
- GO|GORAB|NTKLBP1|SCYL1BP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV
- Uniprot:
- Q5T7V8
- Synonyme:
- GO;N-terminal kinase-like-binding protein 1;NTKL-binding protein 1;NTKLBP1;RAB6-interacting golgin;SCY1-like 1-binding protein 1;SCYL1-binding protein 1;SCYL1BP1
- Weitere Details:
- This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described.
- Versandbedingungen:
- Blue Ice