MED1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1724
Zusätzliche Namen:: CRSP1|CRSP200|DRIP205|DRIP230|MED1|PBP|PPARBP|PPARGBP|RB18A|TRAP220|TRIP2
Anwendung:: ELISA, WB
Molekulargewicht:: 250kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLP
Uniprot:: Q15648
Synonyme:: activator-recruited cofactor 205 kDa component;ARC205;CRSP1;CRSP200;DRIP205;DRIP230;Mediator complex subunit 1;mediator of RNA polymerase II transcription subunit 1;p53 regulatory protein RB18A;PBP;peroxisome proliferator-activated receptor-binding protein;PPAR-binding protein;PPARBP;PPARG binding protein;PPARGBP;RB18A;thyroid hormone receptor-associated protein complex 220 kDa component;thyroid hormone receptor-associated protein complex component TRAP220;thyroid receptor interacting protein 2;Thyroid receptor-interacting protein 2;TR-interacting protein 2;TRAP220;TRIP-2;TRIP2;vitamin D receptor-interacting protein 230 kD;vitamin D receptor-interacting protein complex component DRIP205
Weitere Details:: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. It also regulates p53-dependent apoptosis and it is essential for adipogenesis. This protein is known to have the ability to self-oligomerize.

Versandbedingungen:: Blue Ice