ZCCHC3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17235
Zusätzliche Namen:: C20orf99|ZCCHC3
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: SFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTC
Uniprot:: Q9NUD5
Synonyme:: C20orf99;zinc finger CCHC domain-containing protein 3;zinc finger, CCHC domain containing 3
Weitere Details:: Enables double-stranded DNA binding activity. Involved in several processes, including cellular response to exogenous dsRNA; detection of virus; and positive regulation of RIG-I signaling pathway. Located in cytoplasm.